Lineage for d2ra5a1 (2ra5 A:66-245)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611610Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 2611611Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 2611626Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 2611654Protein Putative transcriptional regulator SCO6256 [160409] (1 species)
  7. 2611655Species Streptomyces coelicolor [TaxId:1902] [160410] (1 PDB entry)
    Uniprot Q9RKT6 66-245
  8. 2611656Domain d2ra5a1: 2ra5 A:66-245 [151819]
    complexed with ipa, srt

Details for d2ra5a1

PDB Entry: 2ra5 (more details), 2.4 Å

PDB Description: Crystal structure of the putative transcriptional regulator from Streptomyces coelicolor
PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d2ra5a1:

Sequence, based on SEQRES records: (download)

>d2ra5a1 d.190.1.2 (A:66-245) Putative transcriptional regulator SCO6256 {Streptomyces coelicolor [TaxId: 1902]}
gllvrrrgvgtqvvhskvrrplelsslyddleaagqrpatkvlvntvvpataeiaaalgv
aedsevhrierlrlthgepmaylcnylppglvdldtgqleatglyrlmraagitlhsarq
sigaraatsgeaerlgedagaplltmerttfddtgravefgthtyrpsrysfefqllvrp

Sequence, based on observed residues (ATOM records): (download)

>d2ra5a1 d.190.1.2 (A:66-245) Putative transcriptional regulator SCO6256 {Streptomyces coelicolor [TaxId: 1902]}
gllvrrrpatkvlvntvvpataeiaaalgvaedsevhrierlrlthgepmaylcnylppg
lvdldtgqleatglyrlmraagitlhsarqsigaraatsgeaerlgedagaplltmertt
fddtgravefgthtyrpsrysfefqllvrp

SCOPe Domain Coordinates for d2ra5a1:

Click to download the PDB-style file with coordinates for d2ra5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ra5a1: