SCOP 1.75: Domain d2ra5a1: 2ra5 A:66-245

Lineage for d2ra5a1 (2ra5 A:66-245)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (3 families)

5. Family d.190.1.2: UTRA domain [143473] (10 proteins)
   Pfam PF07702

6. Protein Putative transcriptional regulator SCO6256 [160409] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [160410] (1 PDB entry)
   Uniprot Q9RKT6 66-245

8. Domain d2ra5a1: 2ra5 A:66-245 [151819]
   complexed with ipa, srt

Details for d2ra5a1

PDB Entry: 2ra5, 2.4 Å

PDB Description: Crystal structure of the putative transcriptional regulator from Streptomyces coelicolor

PDB Compounds: (A:) Putative transcriptional regulator

SCOP Domain Sequences for d2ra5a1:

Sequence, based on SEQRES records:

>d2ra5a1 d.190.1.2 (A:66-245) Putative transcriptional regulator SCO6256 {Streptomyces coelicolor [TaxId: 1902]}
gllvrrrgvgtqvvhskvrrplelsslyddleaagqrpatkvlvntvvpataeiaaalgv
aedsevhrierlrlthgepmaylcnylppglvdldtgqleatglyrlmraagitlhsarq
sigaraatsgeaerlgedagaplltmerttfddtgravefgthtyrpsrysfefqllvrp

Sequence, based on observed residues (ATOM records):

>d2ra5a1 d.190.1.2 (A:66-245) Putative transcriptional regulator SCO6256 {Streptomyces coelicolor [TaxId: 1902]}
gllvrrrpatkvlvntvvpataeiaaalgvaedsevhrierlrlthgepmaylcnylppg
lvdldtgqleatglyrlmraagitlhsarqsigaraatsgeaerlgedagaplltmertt
fddtgravefgthtyrpsrysfefqllvrp

Timeline for d2ra5a1:

• d2ra5a1 is new in SCOP 1.75
  
• d2ra5a1 appears in SCOPe 2.01
  
• d2ra5a1 appears in the current release, SCOPe 2.08