Lineage for d2ra3c_ (2ra3 C:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063244Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1063245Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1063246Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1063283Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 1063284Species Cow (Bos taurus) [TaxId:9913] [57365] (84 PDB entries)
  8. 1063292Domain d2ra3c_: 2ra3 C: [151817]
    Other proteins in same PDB: d2ra3a_, d2ra3b_
    automated match to d1bpia_
    complexed with ca, so4

Details for d2ra3c_

PDB Entry: 2ra3 (more details), 1.46 Å

PDB Description: human cationic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (C:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d2ra3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra3c_ g.8.1.1 (C:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d2ra3c_:

Click to download the PDB-style file with coordinates for d2ra3c_.
(The format of our PDB-style files is described here.)

Timeline for d2ra3c_: