Lineage for d2ra2c_ (2ra2 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 949024Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 949049Protein Uncharacterized protein YgdI [159055] (1 species)
  7. 949050Species Salmonella typhimurium [TaxId:90371] [159056] (1 PDB entry)
    Uniprot Q7CPV8 23-75
  8. 949053Domain d2ra2c_: 2ra2 C: [151813]
    automated match to d2ra2a1

Details for d2ra2c_

PDB Entry: 2ra2 (more details), 1.9 Å

PDB Description: X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A. Northeast Structural Genomics Consortium target StR88A
PDB Compounds: (C:) Putative lipoprotein

SCOPe Domain Sequences for d2ra2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra2c_ b.38.1.6 (C:) Uncharacterized protein YgdI {Salmonella typhimurium [TaxId: 90371]}
gpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalenl

SCOPe Domain Coordinates for d2ra2c_:

Click to download the PDB-style file with coordinates for d2ra2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ra2c_: