Lineage for d1mnka_ (1mnk A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 557Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 580Domain d1mnka_: 1mnk A: [15181]

Details for d1mnka_

PDB Entry: 1mnk (more details), 2.2 Å

PDB Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin

SCOP Domain Sequences for d1mnka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnka_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkvgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgf

SCOP Domain Coordinates for d1mnka_:

Click to download the PDB-style file with coordinates for d1mnka_.
(The format of our PDB-style files is described here.)

Timeline for d1mnka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mnkb_