![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein AMPC beta-Lactamase, class C [56618] (4 species) contains small alpha+beta subdomain inserted in the common fold |
![]() | Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries) |
![]() | Domain d2r9xb_: 2r9x B: [151809] automated match to d1c3ba_ complexed with dms, po4, wh6 |
PDB Entry: 2r9x (more details), 1.9 Å
SCOPe Domain Sequences for d2r9xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9xb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
Timeline for d2r9xb_: