Lineage for d2r9ra_ (2r9r A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338786Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1338787Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1339007Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 1339008Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (10 PDB entries)
  8. 1339013Domain d2r9ra_: 2r9r A: [151802]
    automated match to d1exba_
    complexed with k, nap, pgw

Details for d2r9ra_

PDB Entry: 2r9r (more details), 2.4 Å

PDB Description: Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit
PDB Compounds: (A:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d2r9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ra_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
aiqvlpklsssivheidsilgnkpys

SCOPe Domain Coordinates for d2r9ra_:

Click to download the PDB-style file with coordinates for d2r9ra_.
(The format of our PDB-style files is described here.)

Timeline for d2r9ra_: