Lineage for d2r9hf2 (2r9h F:107-210)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786046Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)
  8. 786054Domain d2r9hf2: 2r9h F:107-210 [151787]
    Other proteins in same PDB: d2r9hd1, d2r9hf1
    automatically matched to d1dqdl2
    complexed with cl; mutant

Details for d2r9hf2

PDB Entry: 2r9h (more details), 3.1 Å

PDB Description: crystal structure of q207c mutant of clc-ec1 in complex with fab
PDB Compounds: (F:) fab fragment

SCOP Domain Sequences for d2r9hf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9hf2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2r9hf2:

Click to download the PDB-style file with coordinates for d2r9hf2.
(The format of our PDB-style files is described here.)

Timeline for d2r9hf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r9hf1