Lineage for d2r9hd1 (2r9h D:1-105)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782710Species Escherichia coli [TaxId:562] [158860] (3 PDB entries)
  8. 782717Domain d2r9hd1: 2r9h D:1-105 [151784]
    Other proteins in same PDB: d2r9hd2, d2r9hf2
    automatically matched to d1dqdl1
    complexed with cl; mutant

Details for d2r9hd1

PDB Entry: 2r9h (more details), 3.1 Å

PDB Description: crystal structure of q207c mutant of clc-ec1 in complex with fab
PDB Compounds: (D:) fab fragment

SCOP Domain Sequences for d2r9hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9hd1 b.1.1.1 (D:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Escherichia coli [TaxId: 562]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOP Domain Coordinates for d2r9hd1:

Click to download the PDB-style file with coordinates for d2r9hd1.
(The format of our PDB-style files is described here.)

Timeline for d2r9hd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r9hd2