Lineage for d2r9gl_ (2r9g L:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496305Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1496306Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1496367Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
    automatically mapped to Pfam PF12002
  6. 1496368Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)
  7. 1496369Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
    Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328
  8. 1496381Domain d2r9gl_: 2r9g L: [151779]
    automated match to d2r9ga1
    complexed with act, gol

Details for d2r9gl_

PDB Entry: 2r9g (more details), 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium
PDB Compounds: (L:) AAA ATPase, central region

SCOPe Domain Sequences for d2r9gl_:

Sequence, based on SEQRES records: (download)

>d2r9gl_ a.80.1.2 (L:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
gdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeq
algqqyyrikewke

Sequence, based on observed residues (ATOM records): (download)

>d2r9gl_ a.80.1.2 (L:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
gdvpdhlrdshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqy
yrikewke

SCOPe Domain Coordinates for d2r9gl_:

Click to download the PDB-style file with coordinates for d2r9gl_.
(The format of our PDB-style files is described here.)

Timeline for d2r9gl_: