Lineage for d2r9gl2 (2r9g L:230-422)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719131Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2719132Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2719193Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
    automatically mapped to Pfam PF12002
  6. 2719194Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)
  7. 2719195Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
    Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328
  8. 2719211Domain d2r9gl2: 2r9g L:230-422 [151779]
    Other proteins in same PDB: d2r9ga2, d2r9gb3, d2r9gc2, d2r9gd3, d2r9ge3, d2r9gf3, d2r9gg3, d2r9gh3, d2r9gi3, d2r9gj3, d2r9gk3, d2r9gl3, d2r9gm3, d2r9gn3, d2r9go3, d2r9gp3
    automated match to d2r9ga1
    complexed with act, gol

Details for d2r9gl2

PDB Entry: 2r9g (more details), 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium
PDB Compounds: (L:) AAA ATPase, central region

SCOPe Domain Sequences for d2r9gl2:

Sequence, based on SEQRES records: (download)

>d2r9gl2 a.80.1.2 (L:230-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
gdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeq
algqqyyrikewk

Sequence, based on observed residues (ATOM records): (download)

>d2r9gl2 a.80.1.2 (L:230-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
althdkngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyedigl
gnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregka
gdvpdhlrdshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqy
yrikewk

SCOPe Domain Coordinates for d2r9gl2:

Click to download the PDB-style file with coordinates for d2r9gl2.
(The format of our PDB-style files is described here.)

Timeline for d2r9gl2: