Class a: All alpha proteins [46456] (289 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins) automatically mapped to Pfam PF12002 |
Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species) |
Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries) Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328 |
Domain d2r9gj2: 2r9g J:236-422 [151777] Other proteins in same PDB: d2r9ga2, d2r9gb3, d2r9gc2, d2r9gd3, d2r9ge3, d2r9gf3, d2r9gg3, d2r9gh3, d2r9gi3, d2r9gj3, d2r9gk3, d2r9gl3, d2r9gm3, d2r9gn3, d2r9go3, d2r9gp3 automated match to d2r9ga1 complexed with act, gol |
PDB Entry: 2r9g (more details), 2.09 Å
SCOPe Domain Sequences for d2r9gj2:
Sequence, based on SEQRES records: (download)
>d2r9gj2 a.80.1.2 (J:236-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} ngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaa artvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdh lrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqy yrikewk
>d2r9gj2 a.80.1.2 (J:236-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]} ngdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaa artvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdh lrdshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewk
Timeline for d2r9gj2:
View in 3D Domains from other chains: (mouse over for more information) d2r9ga1, d2r9ga2, d2r9gb2, d2r9gb3, d2r9gc1, d2r9gc2, d2r9gd2, d2r9gd3, d2r9ge2, d2r9ge3, d2r9gf2, d2r9gf3, d2r9gg2, d2r9gg3, d2r9gh2, d2r9gh3, d2r9gi2, d2r9gi3, d2r9gk2, d2r9gk3, d2r9gl2, d2r9gl3, d2r9gm2, d2r9gm3, d2r9gn2, d2r9gn3, d2r9go2, d2r9go3, d2r9gp2, d2r9gp3 |