Lineage for d2r9gh_ (2r9g H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740605Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 1740606Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 1740667Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
    automatically mapped to Pfam PF12002
  6. 1740668Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)
  7. 1740669Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
    Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328
  8. 1740677Domain d2r9gh_: 2r9g H: [151775]
    automated match to d2r9ga1
    complexed with act, gol

Details for d2r9gh_

PDB Entry: 2r9g (more details), 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium
PDB Compounds: (H:) AAA ATPase, central region

SCOPe Domain Sequences for d2r9gh_:

Sequence, based on SEQRES records: (download)

>d2r9gh_ a.80.1.2 (H:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyr
ikewke

Sequence, based on observed residues (ATOM records): (download)

>d2r9gh_ a.80.1.2 (H:) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshyrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke

SCOPe Domain Coordinates for d2r9gh_:

Click to download the PDB-style file with coordinates for d2r9gh_.
(The format of our PDB-style files is described here.)

Timeline for d2r9gh_: