SCOPe 2.08: Domain d2r9gc1: 2r9g C:237-422

Lineage for d2r9gc1 (2r9g C:237-422)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
   automatically mapped to Pfam PF12002

6. Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
   Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328

8. Domain d2r9gc1: 2r9g C:237-422 [151770]
   Other proteins in same PDB: d2r9ga2, d2r9gb3, d2r9gc2, d2r9gd3, d2r9ge3, d2r9gf3, d2r9gg3, d2r9gh3, d2r9gi3, d2r9gj3, d2r9gk3, d2r9gl3, d2r9gm3, d2r9gn3, d2r9go3, d2r9gp3
   automated match to d2r9ga1
   complexed with act, gol

Details for d2r9gc1

PDB Entry: 2r9g, 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium

PDB Compounds: (C:) AAA ATPase, central region

SCOPe Domain Sequences for d2r9gc1:

Sequence, based on SEQRES records:

>d2r9gc1 a.80.1.2 (C:237-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
gdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaa
rtvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhl
rdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyy
rikewk

Sequence, based on observed residues (ATOM records):

>d2r9gc1 a.80.1.2 (C:237-422) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
gdahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaa
rtvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhl
rdshyknrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikew
k

Timeline for d2r9gc1:

• d2r9gc1 first appeared in SCOP 1.75
  
• d2r9gc1 appears in SCOPe 2.07