Lineage for d2r9gb1 (2r9g B:238-423)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772824Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 772825Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 772886Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
  6. 772887Protein Uncharacterized protein EfaeDRAFT_0938 [158603] (1 species)
  7. 772888Species Enterococcus faecium [TaxId:1352] [158604] (2 PDB entries)
    Uniprot Q3XY27 238-423! Uniprot Q3XY27 241-328
  8. 772890Domain d2r9gb1: 2r9g B:238-423 [151769]
    automatically matched to 2R9G A:238-423
    complexed with act, gol

Details for d2r9gb1

PDB Entry: 2r9g (more details), 2.09 Å

PDB Description: crystal structure of the c-terminal fragment of aaa atpase from enterococcus faecium
PDB Compounds: (B:) AAA ATPase, central region

SCOP Domain Sequences for d2r9gb1:

Sequence, based on SEQRES records: (download)

>d2r9gb1 a.80.1.2 (B:238-423) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyr
ikewke

Sequence, based on observed residues (ATOM records): (download)

>d2r9gb1 a.80.1.2 (B:238-423) Uncharacterized protein EfaeDRAFT_0938 {Enterococcus faecium [TaxId: 1352]}
dahydvisafqksirgsdvdaalhylarlveagdlasicrrlmvigyediglgnpaaaar
tvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladiregkagdvpdhlr
dshynrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqqyyrikewke

SCOP Domain Coordinates for d2r9gb1:

Click to download the PDB-style file with coordinates for d2r9gb1.
(The format of our PDB-style files is described here.)

Timeline for d2r9gb1: