Lineage for d2r9ca_ (2r9c A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889418Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 1889419Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 1889437Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
    Uniprot P97571 33-353
  8. 1889440Domain d2r9ca_: 2r9c A: [151766]
    automated match to d1tloa_
    complexed with ca, cl, gol, grd

Details for d2r9ca_

PDB Entry: 2r9c (more details), 1.8 Å

PDB Description: calpain 1 proteolytic core inactivated by zlak-3001, an alpha- ketoamide
PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2r9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ca_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt

SCOPe Domain Coordinates for d2r9ca_:

Click to download the PDB-style file with coordinates for d2r9ca_.
(The format of our PDB-style files is described here.)

Timeline for d2r9ca_: