Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species) |
Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries) |
Domain d2r9bb_: 2r9b B: [151765] automated match to d1leea_ |
PDB Entry: 2r9b (more details), 2.8 Å
SCOPe Domain Sequences for d2r9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9bb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi lgdpfmrkyftvfdydnhsvgialakknl
Timeline for d2r9bb_: