| Class b: All beta proteins [48724] (180 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species) N-terminal domain belongs to the RBD family (54929) |
| Species Human (Homo sapiens) [TaxId:9606] [141504] (2 PDB entries) Uniprot Q9UNP9 138-301 structure of the N-terminal RBD is known, PDB 2cqb |
| Domain d2r99a_: 2r99 A: [151763] automated match to d1zcxa1 |
PDB Entry: 2r99 (more details), 1.61 Å
SCOPe Domain Sequences for d2r99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r99a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
snpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfm
cqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdw
ldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv
Timeline for d2r99a_: