SCOPe 2.08: Domain d2r99a_: 2r99 A:

Lineage for d2r99a_ (2r99 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species)
   N-terminal domain belongs to the RBD family (54929)

7. Species Human (Homo sapiens) [TaxId:9606] [141504] (2 PDB entries)
   Uniprot Q9UNP9 138-301
   structure of the N-terminal RBD is known, PDB 2cqb

8. Domain d2r99a_: 2r99 A: [151763]
   automated match to d1zcxa1

Details for d2r99a_

PDB Entry: 2r99, 1.61 Å

PDB Description: crystal structure of cyclophilin abh-like domain of human peptidylprolyl isomerase e isoform 1

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2r99a_:

Sequence; same for both SEQRES and ATOM records:

>d2r99a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
snpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfm
cqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdw
ldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv

Timeline for d2r99a_:

• d2r99a_ first appeared in SCOP 1.75, called d2r99a1
  
• d2r99a_ appears in SCOPe 2.07