SCOP 1.65: Domain d1myib_: 1myi B:

Lineage for d1myib_ (1myi B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1myib_: 1myi B: [15176]
   complexed with hem; mutant

Details for d1myib_

PDB Entry: 1myi, 2 Å

PDB Description: high resolution x-ray structures of pig metmyoglobin and two cd3 mutants mb(lys45-> arg) and mb(lys45-> ser)

SCOP Domain Sequences for d1myib_:

Sequence; same for both SEQRES and ATOM records:

>d1myib_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdsfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1myib_:

• d1myib_ first appeared (with stable ids) in SCOP 1.55
  
• d1myib_ appears in SCOP 1.63
  
• d1myib_ appears in SCOP 1.67
  
• d1myib_ appears in the current release, SCOPe 2.08