Lineage for d2r8ub1 (2r8u B:2-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712062Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
    member of rp/eb family
  7. 2712063Species Human (Homo sapiens) [TaxId:9606] [101195] (5 PDB entries)
    Uniprot Q15691 2-132
  8. 2712067Domain d2r8ub1: 2r8u B:2-131 [151744]
    Other proteins in same PDB: d2r8ua_
    automatically matched to d1vkaa_
    complexed with moo

Details for d2r8ub1

PDB Entry: 2r8u (more details), 1.35 Å

PDB Description: structure of fragment of human end-binding protein 1 (eb1) containing the n-terminal domain at 1.35 a resolution
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2r8ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8ub1 a.40.1.1 (B:2-131) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaarq

SCOPe Domain Coordinates for d2r8ub1:

Click to download the PDB-style file with coordinates for d2r8ub1.
(The format of our PDB-style files is described here.)

Timeline for d2r8ub1: