SCOPe 2.08: Domain d2r8ub1: 2r8u B:2-131

Lineage for d2r8ub1 (2r8u B:2-131)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species)
   member of rp/eb family

7. Species Human (Homo sapiens) [TaxId:9606] [101195] (5 PDB entries)
   Uniprot Q15691 2-132

8. Domain d2r8ub1: 2r8u B:2-131 [151744]
   Other proteins in same PDB: d2r8ua_
   automatically matched to d1vkaa_
   complexed with moo

Details for d2r8ub1

PDB Entry: 2r8u, 1.35 Å

PDB Description: structure of fragment of human end-binding protein 1 (eb1) containing the n-terminal domain at 1.35 a resolution

PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2r8ub1:

Sequence; same for both SEQRES and ATOM records:

>d2r8ub1 a.40.1.1 (B:2-131) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]}
avnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkv
kfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydg
kdydpvaarq

Timeline for d2r8ub1:

• d2r8ub1 first appeared in SCOP 1.75
  
• d2r8ub1 appears in SCOPe 2.07