SCOPe 2.08: Domain d2r8ua_: 2r8u A:

Lineage for d2r8ua_ (2r8u A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)

8. Domain d2r8ua_: 2r8u A: [151743]
   Other proteins in same PDB: d2r8ub1
   automated match to d1vkaa_
   complexed with moo

Details for d2r8ua_

PDB Entry: 2r8u, 1.35 Å

PDB Description: structure of fragment of human end-binding protein 1 (eb1) containing the n-terminal domain at 1.35 a resolution

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d2r8ua_:

Sequence; same for both SEQRES and ATOM records:

>d2r8ua_ a.40.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
gkdydpvaarq

Timeline for d2r8ua_:

• d2r8ua_ first appeared in SCOP 1.75, called d2r8ua1
  
• d2r8ua_ appears in SCOPe 2.07