Lineage for d2r8pb3 (2r8p B:528-663)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834848Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 834867Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 834883Species Escherichia coli [TaxId:562] [89712] (4 PDB entries)
  8. 834889Domain d2r8pb3: 2r8p B:528-663 [151742]
    Other proteins in same PDB: d2r8pa1, d2r8pa2, d2r8pb1, d2r8pb2
    automatically matched to d1qgda3
    complexed with ca, edo, t6f

Details for d2r8pb3

PDB Entry: 2r8p (more details), 1.65 Å

PDB Description: transketolase from e. coli in complex with substrate d-fructose-6- phosphate
PDB Compounds: (B:) Transketolase 1

SCOP Domain Sequences for d2r8pb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8pb3 c.48.1.1 (B:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]}
rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd
afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee
fgftvdnvvakakell

SCOP Domain Coordinates for d2r8pb3:

Click to download the PDB-style file with coordinates for d2r8pb3.
(The format of our PDB-style files is described here.)

Timeline for d2r8pb3: