SCOPe 2.04: Domain d2r8pa1: 2r8p A:333-527

Lineage for d2r8pa1 (2r8p A:333-527)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family
6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255577] (2 PDB entries)

8. Domain d2r8pa1: 2r8p A:333-527 [151737]
   Other proteins in same PDB: d2r8pa2, d2r8pa3, d2r8pb2, d2r8pb3
   automated match to d2r8ob1
   complexed with ca, edo, t6f

Details for d2r8pa1

PDB Entry: 2r8p, 1.65 Å

PDB Description: transketolase from e. coli in complex with substrate d-fructose-6- phosphate

PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d2r8pa1:

Sequence; same for both SEQRES and ATOM records:

>d2r8pa1 c.36.1.0 (A:333-527) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

Timeline for d2r8pa1:

• d2r8pa1 first appeared in SCOP 1.75
  
• d2r8pa1 appears in SCOPe 2.03
  
• d2r8pa1 appears in SCOPe 2.05
  
• d2r8pa1 appears in the current release, SCOPe 2.08