Lineage for d2r8ob2 (2r8o B:2-332)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162805Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 1162824Protein Transketolase (TK), PP module [88761] (4 species)
  7. 1162840Species Escherichia coli [TaxId:562] [89656] (4 PDB entries)
  8. 1162842Domain d2r8ob2: 2r8o B:2-332 [151735]
    Other proteins in same PDB: d2r8oa1, d2r8oa3, d2r8ob1, d2r8ob3
    automatically matched to d1qgda2
    complexed with ca, edo, t5x

Details for d2r8ob2

PDB Entry: 2r8o (more details), 1.47 Å

PDB Description: transketolase from e. coli in complex with substrate d-xylulose-5- phosphate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d2r8ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8ob2 c.36.1.10 (B:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]}
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkge

SCOPe Domain Coordinates for d2r8ob2:

Click to download the PDB-style file with coordinates for d2r8ob2.
(The format of our PDB-style files is described here.)

Timeline for d2r8ob2: