Lineage for d2r8oa1 (2r8o A:333-527)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122891Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2122892Protein automated matches [227126] (20 species)
    not a true protein
  7. 2122962Species Escherichia coli K-12 [TaxId:83333] [255577] (2 PDB entries)
  8. 2122963Domain d2r8oa1: 2r8o A:333-527 [151731]
    Other proteins in same PDB: d2r8oa2, d2r8oa3, d2r8ob2, d2r8ob3, d2r8ob4
    automated match to d2r8oa1
    complexed with ca, edo, t5x

Details for d2r8oa1

PDB Entry: 2r8o (more details), 1.47 Å

PDB Description: transketolase from e. coli in complex with substrate d-xylulose-5- phosphate
PDB Compounds: (A:) Transketolase 1

SCOPe Domain Sequences for d2r8oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8oa1 c.36.1.0 (A:333-527) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

SCOPe Domain Coordinates for d2r8oa1:

Click to download the PDB-style file with coordinates for d2r8oa1.
(The format of our PDB-style files is described here.)

Timeline for d2r8oa1: