Lineage for d2r8jb1 (2r8j B:390-509)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008509Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)
  8. 3008516Domain d2r8jb1: 2r8j B:390-509 [151725]
    Other proteins in same PDB: d2r8ja2, d2r8ja3, d2r8jb2
    automated match to d3mfha2
    protein/DNA complex; complexed with ca, cpt, dcp

Details for d2r8jb1

PDB Entry: 2r8j (more details), 3.1 Å

PDB Description: Structure of the Eukaryotic DNA Polymerase eta in complex with 1,2-d(GpG)-cisplatin containing DNA
PDB Compounds: (B:) DNA Polymerase ETA

SCOPe Domain Sequences for d2r8jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8jb1 d.240.1.0 (B:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

SCOPe Domain Coordinates for d2r8jb1:

Click to download the PDB-style file with coordinates for d2r8jb1.
(The format of our PDB-style files is described here.)

Timeline for d2r8jb1: