SCOP 1.75: Domain d2r8ha2: 2r8h A:1-240

Lineage for d2r8ha2 (2r8h A:1-240)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)

6. Protein DinB homolog (DBH) [100889] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)

8. Domain d2r8ha2: 2r8h A:1-240 [151720]
   Other proteins in same PDB: d2r8ha1
   automatically matched to d1jx4a2
   complexed with ca, dgt, p; mutant

Details for d2r8ha2

PDB Entry: 2r8h, 2.48 Å

PDB Description: Selectivity of Nucleoside Triphosphate Incorporation Opposite 1,N2-Propanodeoxyguanosine (PdG) by the Sulfolobus solfataricus DNA Polymerase Dpo4 Polymerase

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2r8ha2:

Sequence; same for both SEQRES and ATOM records:

>d2r8ha2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

Timeline for d2r8ha2:

• d2r8ha2 is new in SCOP 1.75
  
• d2r8ha2 appears in SCOPe 2.01
  
• d2r8ha2 appears in the current release, SCOPe 2.08