Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein DinB homolog (DBH) [100889] (3 species) |
Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries) |
Domain d2r8ga2: 2r8g A:1-240 [151718] Other proteins in same PDB: d2r8ga1 automated match to d1jx4a2 protein/DNA complex; complexed with ca, dgt |
PDB Entry: 2r8g (more details), 2.7 Å
SCOPe Domain Sequences for d2r8ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8ga2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d2r8ga2: