![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily) beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology |
![]() | Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) ![]() |
![]() | Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins) |
![]() | Protein DinB homolog (DBH) [100881] (3 species) |
![]() | Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries) |
![]() | Domain d2r8ga1: 2r8g A:241-341 [151717] Other proteins in same PDB: d2r8ga2 automated match to d1jx4a1 protein/DNA complex; complexed with ca, dgt |
PDB Entry: 2r8g (more details), 2.7 Å
SCOPe Domain Sequences for d2r8ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8ga1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr tfphgisketaysesvkllqkileederkirrigvrfskfi
Timeline for d2r8ga1: