Lineage for d2r8fa2 (2r8f A:2-143)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239247Fold d.216: Rotavirus NSP2 fragment, N-terminal domain [75573] (1 superfamily)
    consists of six alpha-helices and two beta-hairpins
  4. 2239248Superfamily d.216.1: Rotavirus NSP2 fragment, N-terminal domain [75574] (2 families) (S)
  5. 2239249Family d.216.1.1: Rotavirus NSP2 fragment, N-terminal domain [75575] (1 protein)
  6. 2239250Protein Rotavirus NSP2 fragment, N-terminal domain [75576] (1 species)
  7. 2239251Species Simian 11 rotavirus [TaxId:10923] [75577] (5 PDB entries)
  8. 2239255Domain d2r8fa2: 2r8f A:2-143 [151716]
    Other proteins in same PDB: d2r8fa1
    automatically matched to d1l9va2
    protein/RNA complex; complexed with ags, po4

Details for d2r8fa2

PDB Entry: 2r8f (more details), 2.8 Å

PDB Description: crystal structure of h225a nsp2 and atp-gs complex
PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOPe Domain Sequences for d2r8fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8fa2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
aelacfcyphlendsykfipfnnlaikamltakvdkkdmdkfydsiiygiapppqfkkry
ntndnsrgmnfetimftkvamlicealnslkvtqanvsnvlsrvvsirhlenlvirkenp
qdilfhskdlllkstliaigqs

SCOPe Domain Coordinates for d2r8fa2:

Click to download the PDB-style file with coordinates for d2r8fa2.
(The format of our PDB-style files is described here.)

Timeline for d2r8fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r8fa1