Lineage for d2r8fa1 (2r8f A:144-312)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852844Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 852975Superfamily d.13.2: Rotavirus NSP2 fragment, C-terminal domain [75347] (1 family) (S)
  5. 852976Family d.13.2.1: Rotavirus NSP2 fragment, C-terminal domain [75348] (1 protein)
  6. 852977Protein Rotavirus NSP2 fragment, C-terminal domain [75349] (1 species)
  7. 852978Species Simian 11 rotavirus [TaxId:10923] [75350] (5 PDB entries)
  8. 852981Domain d2r8fa1: 2r8f A:144-312 [151715]
    Other proteins in same PDB: d2r8fa2
    automatically matched to d1l9va1
    complexed with ags, po4; mutant

Details for d2r8fa1

PDB Entry: 2r8f (more details), 2.8 Å

PDB Description: crystal structure of h225a nsp2 and atp-gs complex
PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOP Domain Sequences for d2r8fa1:

Sequence, based on SEQRES records: (download)

>d2r8fa1 d.13.2.1 (A:144-312) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkgayrivkyssvanhadrvyatfksnvktgvnndfnlldqr
iiwqnwyaftssmkqgntldvckrllfqkmkpeknpfkglstdrkmdev

Sequence, based on observed residues (ATOM records): (download)

>d2r8fa1 d.13.2.1 (A:144-312) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkgayrivkyssvanhadrvyatfksnvndfnlldqriiwqn
wyaftssmkqgntldvckrllfqkmkpeknpfkglstdrkmdev

SCOP Domain Coordinates for d2r8fa1:

Click to download the PDB-style file with coordinates for d2r8fa1.
(The format of our PDB-style files is described here.)

Timeline for d2r8fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r8fa2