SCOP 1.67: Domain d1myja_: 1myj A:

Lineage for d1myja_ (1myj A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1myja_: 1myj A: [15171]

Details for d1myja_

PDB Entry: 1myj, 1.9 Å

PDB Description: distal polarity in ligand binding to myoglobin: structural and functional characterization of a threonine68(e11) mutant

SCOP Domain Sequences for d1myja_:

Sequence; same for both SEQRES and ATOM records:

>d1myja_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1myja_:

• d1myja_ first appeared (with stable ids) in SCOP 1.55
  
• d1myja_ appears in SCOP 1.65
  
• d1myja_ appears in SCOP 1.69
  
• d1myja_ appears in the current release, SCOPe 2.08