![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins) |
![]() | Protein Uncharacterized protein EAJ56179 [159341] (1 species) |
![]() | Species Unidentified organism [TaxId:32644] [159342] (1 PDB entry) 94% identity to the Burkholderia phytofirmans ortholog Bphyt_2089 (Uniprot B2T4I1) |
![]() | Domain d2r8cf1: 2r8c F:2-57,F:369-414 [151708] Other proteins in same PDB: d2r8ca2, d2r8cb2, d2r8cc2, d2r8cd2, d2r8ce2, d2r8cf2, d2r8cg2, d2r8ch2 automatically matched to 2R8C A:2-57,A:369-414 complexed with zn |
PDB Entry: 2r8c (more details), 2.31 Å
SCOP Domain Sequences for d2r8cf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8cf1 b.92.1.9 (F:2-57,F:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} ttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpXriv pgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele
Timeline for d2r8cf1: