Lineage for d2r8bb_ (2r8b B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508244Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2508259Protein Uncharacterized protein Atu2452 [159740] (1 species)
  7. 2508260Species Agrobacterium tumefaciens [TaxId:358] [159741] (1 PDB entry)
    Uniprot A9CHT9 1-203
  8. 2508262Domain d2r8bb_: 2r8b B: [151697]
    automated match to d2r8ba1
    complexed with so4

Details for d2r8bb_

PDB Entry: 2r8b (more details), 2.56 Å

PDB Description: The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58
PDB Compounds: (B:) Uncharacterized protein Atu2452

SCOPe Domain Sequences for d2r8bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8bb_ c.69.1.14 (B:) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}
pmtkdsyfhksragvagaplfvllhgtggdenqffdfgarllpqatilspvgdvsehgaa
rffrrtgegvydmvdleratgkmadfikanrehyqagpviglgfsnganilanvlieqpe
lfdaavlmhplipfepkispakptrrvlitagerdpicpvqltkaleeslkaqggtvetv
whpggheirsgeidavrgflaayg

SCOPe Domain Coordinates for d2r8bb_:

Click to download the PDB-style file with coordinates for d2r8bb_.
(The format of our PDB-style files is described here.)

Timeline for d2r8bb_: