Lineage for d2r87f1 (2r87 F:1-99)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843003Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
    Pfam PF06849; DUF1246
  6. 1843004Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)
  7. 1843010Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries)
    Uniprot Q8U0R7 1-99
  8. 1843020Domain d2r87f1: 2r87 F:1-99 [151694]
    Other proteins in same PDB: d2r87a2, d2r87b2, d2r87c2, d2r87d2, d2r87e2, d2r87f2
    automated match to d2r84a1
    complexed with adp, po4

Details for d2r87f1

PDB Entry: 2r87 (more details), 2.3 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with adp
PDB Compounds: (F:) PurP protein PF1517

SCOPe Domain Sequences for d2r87f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r87f1 c.30.1.8 (F:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes

SCOPe Domain Coordinates for d2r87f1:

Click to download the PDB-style file with coordinates for d2r87f1.
(The format of our PDB-style files is described here.)

Timeline for d2r87f1: