Lineage for d2r84a1 (2r84 A:1-99)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470395Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
    Pfam PF06849; DUF1246
  6. 2470396Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)
  7. 2470402Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries)
    Uniprot Q8U0R7 1-99
  8. 2470405Domain d2r84a1: 2r84 A:1-99 [151672]
    Other proteins in same PDB: d2r84a2, d2r84b2
    complexed with amp, amz, cl, mpd, na

Details for d2r84a1

PDB Entry: 2r84 (more details), 1.9 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with amp and aicar
PDB Compounds: (A:) PurP protein PF1517

SCOPe Domain Sequences for d2r84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r84a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes

SCOPe Domain Coordinates for d2r84a1:

Click to download the PDB-style file with coordinates for d2r84a1.
(The format of our PDB-style files is described here.)

Timeline for d2r84a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r84a2