Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries) Uniprot Q8U0R7 1-99 |
Domain d2r84a1: 2r84 A:1-99 [151672] Other proteins in same PDB: d2r84a2, d2r84b2 complexed with amp, amz, cl, mpd, na |
PDB Entry: 2r84 (more details), 1.9 Å
SCOP Domain Sequences for d2r84a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r84a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes
Timeline for d2r84a1: