Lineage for d2r83a1 (2r83 A:271-393)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115534Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115535Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1115611Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1115637Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 1115638Species Human (Homo sapiens) [TaxId:9606] [158946] (5 PDB entries)
  8. 1115643Domain d2r83a1: 2r83 A:271-393 [151670]
    automatically matched to d1byna_
    complexed with cl

Details for d2r83a1

PDB Entry: 2r83 (more details), 2.7 Å

PDB Description: crystal structure analysis of human synaptotagmin 1 c2a-c2b
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2r83a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r83a1 b.7.1.2 (A:271-393) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdm

SCOPe Domain Coordinates for d2r83a1:

Click to download the PDB-style file with coordinates for d2r83a1.
(The format of our PDB-style files is described here.)

Timeline for d2r83a1: