![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (2 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Homo sapiens [TaxId:9606] [158946] (1 PDB entry) |
![]() | Domain d2r83a1: 2r83 A:271-393 [151670] automatically matched to d1byna_ complexed with cl |
PDB Entry: 2r83 (more details), 2.7 Å
SCOP Domain Sequences for d2r83a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r83a1 b.7.1.2 (A:271-393) Synaptogamin I {Homo sapiens [TaxId: 9606]} eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw sdm
Timeline for d2r83a1: