SCOP 1.75: Domain d2r83a1: 2r83 A:271-393

Lineage for d2r83a1 (2r83 A:271-393)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Homo sapiens [TaxId:9606] [158946] (1 PDB entry)

8. Domain d2r83a1: 2r83 A:271-393 [151670]
   automatically matched to d1byna_
   complexed with cl

Details for d2r83a1

PDB Entry: 2r83, 2.7 Å

PDB Description: crystal structure analysis of human synaptotagmin 1 c2a-c2b

PDB Compounds: (A:) Synaptotagmin-1

SCOP Domain Sequences for d2r83a1:

Sequence; same for both SEQRES and ATOM records:

>d2r83a1 b.7.1.2 (A:271-393) Synaptogamin I {Homo sapiens [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdm

Timeline for d2r83a1:

• d2r83a1 is new in SCOP 1.75
  
• d2r83a1 appears in SCOPe 2.01
  
• d2r83a1 appears in the current release, SCOPe 2.08