Lineage for d2r82a3 (2r82 A:2-376)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219807Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 1219808Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 1219809Species Clostridium symbiosum [TaxId:1512] [56087] (7 PDB entries)
  8. 1219816Domain d2r82a3: 2r82 A:2-376 [151669]
    Other proteins in same PDB: d2r82a1, d2r82a2
    automatically matched to d1ggoa3
    complexed with so4; mutant

Details for d2r82a3

PDB Entry: 2r82 (more details), 3.6 Å

PDB Description: pyruvate phosphate dikinase (ppdk) triple mutant r219e/e271r/s262d adapts a second conformational state
PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOPe Domain Sequences for d2r82a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r82a3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpeaivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpdtgekgiygrylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOPe Domain Coordinates for d2r82a3:

Click to download the PDB-style file with coordinates for d2r82a3.
(The format of our PDB-style files is described here.)

Timeline for d2r82a3: