Lineage for d2r82a1 (2r82 A:510-873)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088170Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
    automatically mapped to Pfam PF02896
  6. 2088171Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (3 species)
  7. 2088172Species Clostridium symbiosum [TaxId:1512] [51631] (7 PDB entries)
  8. 2088179Domain d2r82a1: 2r82 A:510-873 [151667]
    Other proteins in same PDB: d2r82a2, d2r82a3
    automatically matched to d1dika1
    complexed with so4; mutant

Details for d2r82a1

PDB Entry: 2r82 (more details), 3.6 Å

PDB Description: Pyruvate phosphate dikinase (PPDK) triple mutant R219E/E271R/S262D adapts a second conformational state
PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOPe Domain Sequences for d2r82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r82a1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]}
ietqeasvsgsferimvwadkfrtlkvrtnadtpedtlnavklgaegiglcrtehmffea
drimkirkmilsdsveareealnelipfqkgdfkamykalegrpmtvryldpplhefvph
teeeqaelaknmgltlaevkakvdelhefnpmmghrgcrlavtypeiakmqtravmeaai
evkeetgidivpeimiplvgekkelkfvkdvvvevaeqvkkekgsdmqyhigtmieipra
altadaiaeeaeffsfgtndltqmtfgfsrddagkfldsyykakiyesdpfarldqtgvg
qlvemavkkgrqtrpglkcgicgehggdpssvefchkvglnyvscspfrvpiarlaaaqa
alnn

SCOPe Domain Coordinates for d2r82a1:

Click to download the PDB-style file with coordinates for d2r82a1.
(The format of our PDB-style files is described here.)

Timeline for d2r82a1: