Lineage for d2r7zk1 (2r7z K:1-114)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1712169Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1712170Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1712171Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1712172Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 1712173Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 1712178Domain d2r7zk1: 2r7z K:1-114 [151665]
    Other proteins in same PDB: d2r7zb1, d2r7zf1, d2r7zh1, d2r7zj1, d2r7zl1
    automatically matched to d1wcmk_
    protein/DNA complex; protein/RNA complex; complexed with cpt, mg, zn

Details for d2r7zk1

PDB Entry: 2r7z (more details), 3.8 Å

PDB Description: cisplatin lesion containing rna polymerase ii elongation complex
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d2r7zk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7zk1 i.8.1.1 (K:1-114) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2r7zk1:

Click to download the PDB-style file with coordinates for d2r7zk1.
(The format of our PDB-style files is described here.)

Timeline for d2r7zk1: