SCOP 1.75: Domain d2r7zf1: 2r7z F:72-155

Lineage for d2r7zf1 (2r7z F:72-155)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2r7zf1: 2r7z F:72-155 [151661]
   Other proteins in same PDB: d2r7za1, d2r7zb1, d2r7zd1, d2r7zg1, d2r7zh1, d2r7zj1, d2r7zk1, d2r7zl1
   automatically matched to d1i3qf_
   complexed with cpt, mg, zn

Details for d2r7zf1

PDB Entry: 2r7z, 3.8 Å

PDB Description: cisplatin lesion containing rna polymerase ii elongation complex

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOP Domain Sequences for d2r7zf1:

Sequence; same for both SEQRES and ATOM records:

>d2r7zf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2r7zf1:

• d2r7zf1 is new in SCOP 1.75
  
• d2r7zf1 appears in SCOPe 2.01
  
• d2r7zf1 appears in the current release, SCOPe 2.08