Lineage for d2r7na2 (2r7n A:124-361)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671418Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 1671419Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 1671420Species Methanocaldococcus jannaschii [TaxId:2190] [160807] (4 PDB entries)
    Uniprot Q57600 124-361
  8. 1671424Domain d2r7na2: 2r7n A:124-361 [151654]
    Other proteins in same PDB: d2r7na1
    automated match to d2r7ka2
    complexed with adp, cl, fai, so4

Details for d2r7na2

PDB Entry: 2r7n (more details), 2.4 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with adp and faicar
PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOPe Domain Sequences for d2r7na2:

Sequence, based on SEQRES records: (download)

>d2r7na2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfpgarggrgyfiassteefykkaedlk
krgiltdedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakd
qlemninpsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnen
lelvvfemsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

Sequence, based on observed residues (ATOM records): (download)

>d2r7na2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfrgyfiassteefykkaedlkkrgilt
dedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakdqlemni
npsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnenlelvvf
emsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

SCOPe Domain Coordinates for d2r7na2:

Click to download the PDB-style file with coordinates for d2r7na2.
(The format of our PDB-style files is described here.)

Timeline for d2r7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7na1