SCOPe 2.08: Domain d2r7na2: 2r7n A:124-361

Lineage for d2r7na2 (2r7n A:124-361)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
   Pfam PF06973; DUF1297

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [160807] (4 PDB entries)
   Uniprot Q57600 124-361

8. Domain d2r7na2: 2r7n A:124-361 [151654]
   Other proteins in same PDB: d2r7na1
   automated match to d2r7ka2
   complexed with adp, cl, fai, so4

Details for d2r7na2

PDB Entry: 2r7n, 2.4 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with adp and faicar

PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOPe Domain Sequences for d2r7na2:

Sequence, based on SEQRES records:

>d2r7na2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfpgarggrgyfiassteefykkaedlk
krgiltdedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakd
qlemninpsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnen
lelvvfemsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

Sequence, based on observed residues (ATOM records):

>d2r7na2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfrgyfiassteefykkaedlkkrgilt
dedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakdqlemni
npsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnenlelvvf
emsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

Timeline for d2r7na2:

• d2r7na2 first appeared in SCOP 1.75
  
• d2r7na2 appears in SCOPe 2.07