SCOPe 2.07: Domain d2r7ma1: 2r7m A:1-123

Lineage for d2r7ma1 (2r7m A:1-123)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
   Pfam PF06849; DUF1246

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [159530] (4 PDB entries)
   Uniprot Q57600 1-123

8. Domain d2r7ma1: 2r7m A:1-123 [151651]
   Other proteins in same PDB: d2r7ma2
   automated match to d2r7ka1
   complexed with amp, cl, so4

Details for d2r7ma1

PDB Entry: 2r7m, 2.3 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with amp

PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOPe Domain Sequences for d2r7ma1:

Sequence; same for both SEQRES and ATOM records:

>d2r7ma1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
miskdeileifdkynkdeitiatlgshtslhilkgaklegfstvcitmkgrdvpykrfkv
adkfiyvdnfsdikneeiqeklrelnsivvphgsfiaycgldnvensflvpmfgnrrilr
wes

Timeline for d2r7ma1:

• d2r7ma1 first appeared in SCOP 1.75
  
• d2r7ma1 appears in SCOPe 2.06
  
• d2r7ma1 appears in the current release, SCOPe 2.08