Lineage for d2r7ma1 (2r7m A:1-123)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120764Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein)
    Pfam PF06849; DUF1246
  6. 2120765Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species)
  7. 2120766Species Methanocaldococcus jannaschii [TaxId:2190] [159530] (4 PDB entries)
    Uniprot Q57600 1-123
  8. 2120769Domain d2r7ma1: 2r7m A:1-123 [151651]
    Other proteins in same PDB: d2r7ma2
    automated match to d2r7ka1
    complexed with amp, cl, so4

Details for d2r7ma1

PDB Entry: 2r7m (more details), 2.3 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with amp
PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOPe Domain Sequences for d2r7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7ma1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
miskdeileifdkynkdeitiatlgshtslhilkgaklegfstvcitmkgrdvpykrfkv
adkfiyvdnfsdikneeiqeklrelnsivvphgsfiaycgldnvensflvpmfgnrrilr
wes

SCOPe Domain Coordinates for d2r7ma1:

Click to download the PDB-style file with coordinates for d2r7ma1.
(The format of our PDB-style files is described here.)

Timeline for d2r7ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ma2