Lineage for d2r7la2 (2r7l A:124-361)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 874149Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
    Pfam PF06973; DUF1297
  6. 874150Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)
  7. 874151Species Methanocaldococcus jannaschii [TaxId:2190] [160807] (4 PDB entries)
    Uniprot Q57600 124-361
  8. 874153Domain d2r7la2: 2r7l A:124-361 [151650]
    Other proteins in same PDB: d2r7la1
    automatically matched to 2R7K A:124-361
    complexed with amz, atp, cl, so4

Details for d2r7la2

PDB Entry: 2r7l (more details), 2.1 Å

PDB Description: crystal structure of faicar synthetase (purp) from m. jannaschii complexed with atp and aicar
PDB Compounds: (A:) 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase

SCOP Domain Sequences for d2r7la2:

Sequence, based on SEQRES records: (download)

>d2r7la2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfpgarggrgyfiassteefykkaedlk
krgiltdedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakd
qlemninpsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnen
lelvvfemsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

Sequence, based on observed residues (ATOM records): (download)

>d2r7la2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
erslegkllreaglrvpkkyespedidgtvivkfrgyfiassteefykkaedlkkrgilt
dedianahieeyvvgtnfcihyfysplkdevellgmdkryesnidglvripakdqlemni
npsyvitgnipvviresllpqvfemgdklvakakelvppgmigpfclqslcnenlelvvf
emsarvdggtnsfmnggpysflyngeplsmgqriareikmalqldmidkiis

SCOP Domain Coordinates for d2r7la2:

Click to download the PDB-style file with coordinates for d2r7la2.
(The format of our PDB-style files is described here.)

Timeline for d2r7la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7la1