| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
| Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
| Species Methanocaldococcus jannaschii [TaxId:2190] [159530] (4 PDB entries) Uniprot Q57600 1-123 |
| Domain d2r7ka1: 2r7k A:1-123 [151647] Other proteins in same PDB: d2r7ka2 complexed with acp, amz, cl, so4 |
PDB Entry: 2r7k (more details), 2.1 Å
SCOPe Domain Sequences for d2r7ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7ka1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}
miskdeileifdkynkdeitiatlgshtslhilkgaklegfstvcitmkgrdvpykrfkv
adkfiyvdnfsdikneeiqeklrelnsivvphgsfiaycgldnvensflvpmfgnrrilr
wes
Timeline for d2r7ka1: