Lineage for d2r7ja1 (2r7j A:144-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2930045Superfamily d.13.2: Rotavirus NSP2 fragment, C-terminal domain [75347] (2 families) (S)
  5. 2930046Family d.13.2.1: Rotavirus NSP2 fragment, C-terminal domain [75348] (1 protein)
  6. 2930047Protein Rotavirus NSP2 fragment, C-terminal domain [75349] (1 species)
  7. 2930048Species Simian 11 rotavirus [TaxId:10923] [75350] (5 PDB entries)
  8. 2930049Domain d2r7ja1: 2r7j A:144-312 [151645]
    Other proteins in same PDB: d2r7ja2
    automatically matched to d1l9va1
    mutant

Details for d2r7ja1

PDB Entry: 2r7j (more details), 2.6 Å

PDB Description: crystal structure of rotavirus non structural protein nsp2 with h225a mutation
PDB Compounds: (A:) Non-structural RNA-binding protein 35

SCOPe Domain Sequences for d2r7ja1:

Sequence, based on SEQRES records: (download)

>d2r7ja1 d.13.2.1 (A:144-312) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkgayrivkyssvanhadrvyatfksnvktgvnndfnlldqr
iiwqnwyaftssmkqgntldvckrllfqkmkpeknpfkglstdrkmdev

Sequence, based on observed residues (ATOM records): (download)

>d2r7ja1 d.13.2.1 (A:144-312) Rotavirus NSP2 fragment, C-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
keiettitaeggeivfqnaaftmwkltylehqlmpildqnfieykvtlnedkpisdvhvk
elvaelrwqynkfavithgkgayrivkyssvanhadrvyatfksnvktgvnndfnlldqr
iiwqnwyaftssmkqgntldvckrllfqkmkpfkglstdrkmdev

SCOPe Domain Coordinates for d2r7ja1:

Click to download the PDB-style file with coordinates for d2r7ja1.
(The format of our PDB-style files is described here.)

Timeline for d2r7ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7ja2